PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_328440g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 237aa    MW: 27587.5 Da    PI: 10.1364
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_328440g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.58.7e-102391148
                     HHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding 11 llvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +l d+++ +G g W+  +++ g++R++k+c++rw +yl
   MA_328440g0010  2 ILSDYIRIHGDGEWRNLPQKAGLRRCGKSCRLRWMNYL 39
                     5789********************************97 PP

2Myb_DNA-binding41.92.2e-134588146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     rg+ ++ E++l+v+++++lG+  W++Ia +++ gRt++++k+++++
   MA_328440g0010 45 RGNISPYEEDLIVRLHRLLGNQ-WSLIAGRLP-GRTDNEIKNYLNT 88
                     7888999*************99.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.2141IPR001005SANT/Myb domain
PROSITE profilePS5129410.785139IPR017930Myb domain
SuperFamilySSF466894.23E-20285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-16246IPR009057Homeodomain-like
CDDcd001674.64E-4239No hitNo description
PfamPF002491.6E-7339IPR001005SANT/Myb domain
PROSITE profilePS5129422.3314094IPR017930Myb domain
SMARTSM007174.9E-114492IPR001005SANT/Myb domain
PfamPF002491.9E-114588IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.1E-224794IPR009057Homeodomain-like
CDDcd001674.03E-75290No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MILSDYIRIH GDGEWRNLPQ KAGLRRCGKS CRLRWMNYLR PDIKRGNISP YEEDLIVRLH  60
RLLGNQWSLI AGRLPGRTDN EIKNYLNTRL RKKMLPTNDS EPNSITQNLK TGSKFLSAVH  120
DHVLKTTPIK TKAVRYSEMV RPNRSKGSGH SNCNSDEIFT LCSGKETTNS SKPWADLRLN  180
DPVTKDYSEG TPFIMADVNF LETEAENSIL FYVEFRAREI PTITLFWKRR NYFTREF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1759420108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1094860.0BT109486.1 Picea glauca clone GQ03209_A18 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9S9K92e-48MYB3_ARATH; Transcription factor MYB3
TrEMBLF8TJT09e-77F8TJT0_PINRE; MYB-like protein (Fragment)
STRINGVIT_04s0008g01820.t011e-52(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-49myb domain protein 3